PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A11G2240
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 1323aa    MW: 146819 Da    PI: 5.539
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A11G2240genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.61.4e-13853248
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     g W   Ede+l+ av ++G+++W++I++ +  ++++kqck rw+ +l
      Gh_A11G2240  8 GVWKNTEDEILKAAVMKYGKNQWARISSLLV-RKSAKQCKARWYEWL 53
                     78*****************************.************986 PP

2Myb_DNA-binding29.41.9e-0960103248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        WT eEde+l+++ k++++  W+tIa  +g  Rt+ qc + + k+l
      Gh_A11G2240  60 TEWTREEDEKLLHLAKLMPTQ-WRTIAPIVG--RTPSQCLEQYEKLL 103
                      68*****************99.********8..******99999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.008257IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.1E-18556IPR009057Homeodomain-like
SMARTSM007177.0E-15655IPR001005SANT/Myb domain
PfamPF139216.8E-131070No hitNo description
CDDcd001672.80E-121053No hitNo description
SuperFamilySSF466891.26E-1933106IPR009057Homeodomain-like
CDDcd116591.29E-3055106No hitNo description
Gene3DG3DSA:1.10.10.605.0E-1357104IPR009057Homeodomain-like
PROSITE profilePS5129414.22358107IPR017930Myb domain
SMARTSM007177.1E-1258105IPR001005SANT/Myb domain
PfamPF118311.3E-59406654IPR021786Pre-mRNA splicing factor component Cdc5p/Cef1
Gene3DG3DSA:3.40.640.108.0E-819381189IPR015421Pyridoxal phosphate-dependent transferase, major region, subdomain 1
SuperFamilySSF533832.58E-1059401284IPR015424Pyridoxal phosphate-dependent transferase
PfamPF012126.8E-929411228IPR001597Aromatic amino acid beta-eliminating lyase/threonine aldolase
CDDcd065023.62E-1049411272No hitNo description
Gene3DG3DSA:3.90.1150.109.0E-2611901283IPR015422Pyridoxal phosphate-dependent transferase, major region, subdomain 2
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006520Biological Processcellular amino acid metabolic process
GO:0009870Biological Processdefense response signaling pathway, resistance gene-dependent
GO:0010204Biological Processdefense response signaling pathway, resistance gene-independent
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0009507Cellular Componentchloroplast
GO:0003677Molecular FunctionDNA binding
GO:0016829Molecular Functionlyase activity
Sequence ? help Back to Top
Protein Sequence    Length: 1323 aa     Download sequence    Send to blast
MRIMIKGGVW KNTEDEILKA AVMKYGKNQW ARISSLLVRK SAKQCKARWY EWLDPSIKKT  60
EWTREEDEKL LHLAKLMPTQ WRTIAPIVGR TPSQCLEQYE KLLDAACARD ENYEPGDDPR  120
KLRPGEIDPN PESKPARPDP VDMDEDEKEM LSEARARLAN TRGKKAKRKA REKQLEEARR  180
LASLQKRREL KAAGIDTRQR KRKRKGIDYN AEIPFEKRPP PGFYDVADED RPVEQPKFPT  240
TIEELEGKRR VDIEAQLRKQ DIAKNKIAQR QDAASAILQA NKLNDPEAVR KRSKLMLPEP  300
QISNHELEEI AKMGYASDLL AGNEELAEAS SATRALLSNY SQTPRQGVTP LRTPQRTPAG  360
KGDAIMMEAE NLARLRESQT PLLGGENPEL HPSDFSGVTP KMQVQTPNPM LTPAATPGGT  420
GLTPRIGMTP SRDGYSFGLT PKGAPIRDEL HINEDMDLHD SVKLEQQRQA DIRRNLRSGL  480
GSLPQPKNEY QIVIQPPPEE SEEPEEKIEE DMSDRIARER AEEEAQQQAL LKKRSKVLQR  540
ELPRPPSASL ELIRDSLMRT DGDKSTFVPP TLIEQADEMI RKELLSLLEH DNAKYPLDEK  600
ANKGKKKGAK RSANGSIPSI EDFEEDEMKE ADSWVKEEAE FLRVAMGHEN ESLDDFVEAH  660
NTCLSDLMYF PTRHAYGLSS VAGNTEKLAA LQSEFDHVKK KMDNDKLKAE GMEKKFNVLT  720
QGYERRAATL WRQIESTFKQ IDTAGTELEC FQALQKQEQL AASHRINGLW EEVQKQKELE  780
QTSQSRYGNL IAEIERIQKI MNVYRVQAQK QAEAAEKDHA LESSEAPASQ AAVPSSGLSE  840
PAPSSEDVYS SLDGQPSLKI DMNVDSQEQH ATMDLETGGN ISGNVPLVVE DNGDNITKTP  900
AQDAGTSSEV VAESVNPDTV STKPESIEEA LEATMVARTV DLRSDTVTKP TETMRAAMAT  960
AEVDDDVLGA DPTAFRLESE VAKITGKEAG LFVSSGTMGN LISVLVHCDI RGSEVILGDN  1020
SHIHIYENGG ISTIGGVHPR PVKNNEDGTM DIDSIEVAIR DPRGELVFPT TKLICLENSH  1080
ANSGGRCLSA EYTDRVGELA KKNGLKLHID GARIFNASVA LGVPVQRLVQ AADSVSVCLS  1140
KGLGAPVGSV IVGSKSFITK ARRLRKTLGG GMRQVGFICA AAFVALKENV EKLDGDHKKA  1200
KELAEGLTQI KGLKVDVAAV ETNIIYVDIV EGSKITAEKL YKNLEEHGVL VMPKGLSRMR  1260
IVLHHQISSS DVHYTLSCFQ QAFTGMRQEI GSYSISTSRD VSYARDIYMV CDPAVDGALW  1320
RIQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3jb9_W1e-10032242236Pre-mRNA-splicing factor cdc5
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1185204KRRELKAAGIDTRQRKRKRK
2199204RKRKRK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.131510.0boll| ovule
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00028SELEXTransfer from AT1G09770Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012492782.10.0PREDICTED: cell division cycle 5-like protein
SwissprotP929480.0CDC5L_ARATH; Cell division cycle 5-like protein
TrEMBLA0A0B0MFR70.0A0A0B0MFR7_G
STRINGGLYMA20G36600.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM64532742
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09770.10.0cell division cycle 5